PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK24817.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WOX
Protein Properties Length: 375aa    MW: 41610.8 Da    PI: 8.4775
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK24817.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.3e-1854114257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  KFK24817.1  54 KPRWNPKPEQIRILEAIFNSgMVNPPREEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 114
                 89*****************99*************************************995 PP

2Wus_type_Homeobox112.42.4e-3653115264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P++eei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
         KFK24817.1  53 PKPRWNPKPEQIRILEAIFNSGMVNPPREEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 115
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-736113IPR009057Homeodomain-like
PROSITE profilePS5007110.68950115IPR001356Homeobox domain
SuperFamilySSF466893.51E-1251118IPR009057Homeodomain-like
SMARTSM003891.2E-852119IPR001356Homeobox domain
CDDcd000866.43E-953115No hitNo description
PfamPF000468.6E-1654114IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPHPHQ WQHDINSPLL PSSASHRSSP YSSGCEVERS PEPKPRWNPK  60
PEQIRILEAI FNSGMVNPPR EEIRRIRAQL QEYGQVGDAN VFYWFQNRKS RSKHKLRLLH  120
NHSKHSISQQ QPQPQPLSSA NSSSSSSSSS SSSKSTKPRK NKNKNNISNT NLSLGGSQMM  180
GMFPPEAAFL FPVSSTVGGF EGVTVSPQLE FLSGNMIEQQ KPAPTVGPCT GLLLSEIMNG  240
YGTHHHHHLS EKEDEEMRMK MLQPQICYAT QATSYLNNIM LHAPPITSST TTSITTSDSL  300
VTVPSTSDQI PVQASARIRV FINEMELEVS TGPFNVRDAF GEEAVLIDTA GQPIVTDEYG  360
IALHPLQHGA SYYLI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410541.10.0hypothetical protein EUTSA_v10016784mg
SwissprotQ6X7J40.0WOX9_ARATH; WUSCHEL-related homeobox 9
TrEMBLA0A087G4L50.0A0A087G4L5_ARAAL; Uncharacterized protein
STRINGAT2G33880.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72062640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-170homeobox-3